PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.TF4CX
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 420aa    MW: 47732.3 Da    PI: 9.3215
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.TF4CXgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding285e-09111153346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rWT+eE ++l d+++q+  + +  Ia +++  Rtl+++k+r+++
      Aradu.TF4CX 111 RWTKEETDQLFDLCEQFDLR-FIVIADRFPSSRTLEELKDRYYS 153
                      9*******************.*********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF162829.9E-2791158IPR032563DAMP1, SANT/Myb-like domain
SMARTSM007173.9E-8108157IPR001005SANT/Myb domain
SuperFamilySSF466891.47E-6108158IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-6110156IPR009057Homeodomain-like
CDDcd116581.09E-18112154No hitNo description
PfamPF054998.6E-6302357IPR008468DNA methyltransferase 1-associated 1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0000812Cellular ComponentSwr1 complex
GO:0035267Cellular ComponentNuA4 histone acetyltransferase complex
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MDAKDILGLP KNSFPPQEKK SRPPKESQRK PDGISREVYA LTGGLAPLMP AVDSSQLKRR  60
HPPDEKVAWQ WLGFTSSARK DNLHLYHWVR VSVDITRYTD EEYEKYLTDP RWTKEETDQL  120
FDLCEQFDLR FIVIADRFPS SRTLEELKDR YYSVSRALLI ARNPSSVDIA AHPLVKEPYN  180
ISRDVERKRA MSLVLSQTRQ QEQRDEEVLA EAKRIAQSRI PAKVSQESEM AVAPNAGVEV  240
TERTIPGDTV SPPPSNAQHP LIPVPPPLST ENASTLASLR ILRLYLRTYA LEQMLQAASS  300
TAGLRTIKRV EQTLQDLGVN LKPRVPTKAV CAEHLELRKE ILTLLNLQKQ LQYKEAEGLP  360
FREGSFTETP GTPKDRTFVP DSSFGVERTG KRDQKRKAPG RLSEAPSSPA QWQLERFFDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3hm5_A5e-15921621387DNA methyltransferase 1-associated protein 1
4iej_A5e-15921621387DNA methyltransferase 1-associated protein 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016175218.10.0PREDICTED: SWR1-complex protein 4-like
RefseqXP_016175219.10.0PREDICTED: SWR1-complex protein 4-like
RefseqXP_016175220.10.0PREDICTED: SWR1-complex protein 4-like
RefseqXP_016175221.10.0PREDICTED: SWR1-complex protein 4-like
SwissprotQ8VZL60.0SWC4_ARATH; SWR1-complex protein 4
TrEMBLK7MZL60.0K7MZL6_SOYBN; Uncharacterized protein
STRINGGLYMA19G40630.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49752330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47210.10.0MYB_related family protein